Rabbit Polyclonal Anti-PAX6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX6 antibody: synthetic peptide directed towards the N terminal of human PAX6. Synthetic peptide located within the following region: LAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCVSKILGRYYETGSIR |
Rabbit Polyclonal Anti-PAX6 Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX6 antibody: synthetic peptide directed towards the N terminal of human PAX6. Synthetic peptide located within the following region: GRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNQNVSNGCV |
Germany
Japan
United Kingdom
China