Germany
Japan
United Kingdom
China
XRCC1 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Primary Antibodies
View as table Download
XRCC1 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-XRCC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-XRCC1 antibody is: synthetic peptide directed towards the C-terminal region of Human XRCC1. Synthetic peptide located within the following region: GDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLP |
Rabbit Polyclonal Anti-XRCC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XRCC1 Antibody: A synthesized peptide derived from human XRCC1 |
Mouse Monoclonal XRCC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-XRCC1 mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-XRCC1 mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
XRCC1 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- XRCC1
Applications
- WB
Families
- Druggable Genome
Pathways
- Base excision repair