Germany
Japan
United Kingdom
China
USD 509.00
2 Weeks
Primary Antibodies
View as table Download
ATP6V1B1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATP6V1B1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal ATP6V1B1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, C. elegans) |
| Conjugation | Unconjugated |
| Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
ATP6V1B1 mouse monoclonal antibody, clone OTI6D2 (formerly 6D2)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ATP6V1B1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ATP6V1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V1B1 antibody: synthetic peptide directed towards the middle region of human ATP6V1B1. Synthetic peptide located within the following region: LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLL |
Active filters
Target Symbol
- ATP6V1B1
Applications
- WB
Families
- Druggable Genome
Pathways
- Metabolic pathways