Primary Antibodies

View as table Download

Rabbit Polyclonal anti-PDK1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDK1 antibody: synthetic peptide directed towards the middle region of human PDK1. Synthetic peptide located within the following region: ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY

Rabbit Polyclonal Antibody against PDK1

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-Terminal portion of the human PDK1 protein sequence (between residues 350-436). [Swiss-Prot Q15118]

Rabbit Polyclonal Antibody against PDK1

Applications Immunoblotting, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PDK1 protein sequence (between residues 300-400). [Swiss-Prot Q15118]

Rabbit polyclonal PDK1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PDK1.

Goat Polyclonal Antibody against PDK1

Applications WB
Reactivities Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DFKDKSAEDAK, from the internal region of the protein sequence according to NP_002601.1.