Rabbit polyclonal antibody to XRCC2 (X-ray repair complementing defective repair in Chinese hamster cells 2)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 123 of XRCC2 (Uniprot ID#O43543) |
Rabbit Polyclonal Anti-XRCC2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XRCC2 antibody: synthetic peptide directed towards the middle region of human XRCC2. Synthetic peptide located within the following region: CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA |
Germany
Japan
United Kingdom
China
