Primary Antibodies

Jump to Filters
View as table Download
PIP5K2 beta (PIP4K2B) Rabbit Polyclonal Antibody
TA332103

USD 539.00

5 Days

Rabbit Polyclonal Anti-PIP4K2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIP4K2B Antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2B. Synthetic peptide located within the following region: DVYAMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEIS
PIP5K2 beta (PIP4K2B) Rabbit Polyclonal Antibody
TA360258

USD 539.00

5 Days

PIP4K2B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PIP4K2B