Primary Antibodies

Jump to Filters
View as table Download
ATP6V0B (Center) Rabbit Polyclonal Antibody
AP50303PU-N

USD 580.00

2 Weeks

ATP6V0B (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 111-139 amino acids from the Central region of human ATP6V0B
ATP6V0B Rabbit Polyclonal Antibody
TA335996

USD 539.00

5 Days

Rabbit Polyclonal Anti-Atp6v0b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Atp6v0b Antibody is: synthetic peptide directed towards the N-terminal region of Rat Atp6v0b. Synthetic peptide located within the following region: PSNNLFCPSQPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVG