Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
RNF2 (189-201) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Bovine, Canine, Chimpanzee, Chicken, Frog, Human, Mouse, Orang-Utan, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding aa 189-201 of Human RING1B protein |
Rabbit Polyclonal Anti-RNF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RNF2 Antibody: synthetic peptide directed towards the middle region of human RNF2. Synthetic peptide located within the following region: LVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGE |
RING2 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human RING2 / RING1B / RNF2 |
Goat Polyclonal Antibody against RNF2 / dinG
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PMELYYAPTKEHK, from the C Terminus of the protein sequence according to NP_009143.1. |
Rabbit Polyclonal Anti-RNF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RNF2 Antibody: synthetic peptide directed towards the middle region of human RNF2. Synthetic peptide located within the following region: NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVF |
RNF2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human RNF2 |
Active filters
Target Symbol
- RNF2
Applications
- WB
Clonalities
- Polyclonal