Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
ART1 (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human ART1. |
ART1 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the central region of human ART1. |
Rabbit Polyclonal Anti-ART1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ART1 antibody: synthetic peptide directed towards the C terminal of human ART1. Synthetic peptide located within the following region: KHSTYNCEYIKDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAF |
Active filters
Target Symbol
- ART1
Applications
- WB
Clonalities
- Polyclonal