Primary Antibodies

Jump to Filters
View as table Download
FBXO4 (Center) Rabbit Polyclonal Antibody
AP51631PU-N

USD 580.00

2 Weeks

FBXO4 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 231~260 amino acids from the Center region of human FBXO4
FBXO4 Goat Polyclonal Antibody
TA326314

USD 520.00

5 Days

Goat Anti-FBXO4 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-PTAGLPQRQIDG, from the internal region of the protein sequence according to NP_036308.1; NP_277019.1.
FBXO4 Rabbit Polyclonal Antibody
TA329824

USD 539.00

5 Days

Rabbit Polyclonal Anti-FBXO4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO4 antibody: synthetic peptide directed towards the middle region of human FBXO4. Synthetic peptide located within the following region: TSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKSK
FBXO4 Rabbit Polyclonal Antibody
TA329825

USD 539.00

5 Days

Rabbit Polyclonal Anti-FBXO4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO4 antibody: synthetic peptide directed towards the middle region of human FBXO4. Synthetic peptide located within the following region: KRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRA