Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NRF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-NRF1 Antibody is: synthetic peptide directed towards the middle region of Human NRF1. Synthetic peptide located within the following region: WATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSE

Rabbit Polyclonal Anti-NRF1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NRF1 antibody: synthetic peptide directed towards the N terminal of human NRF1. Synthetic peptide located within the following region: MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED

Rabbit polyclonal anti-NRF1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NRF1.

Rabbit anti-NRF1 Polyclonal Antibody

Applications ChIP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NRF1