Primary Antibodies

Jump to Filters
View as table Download
ADCY2 (Center) Rabbit Polyclonal Antibody
AP50086PU-N

USD 580.00

2 Weeks

ADCY2 (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 458-489 amino acids from the Central region of human ADCY2
ADCY2 Rabbit Polyclonal Antibody
TA310096

USD 360.00

3 Weeks

Rabbit anti-ADCY2 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
ADCY2 Rabbit Polyclonal Antibody
TA338425

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ADCY2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCY2 antibody: synthetic peptide directed towards the middle region of human ADCY2. Synthetic peptide located within the following region: FLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLI