Goat Anti-Delta-Sarcoglycan (aa245-257) Antibody
| Applications | WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RLPHGSYTPTGTR, from the internal region of the protein sequence according to NP_000328.2; NP_758447.1; NP_001121681.1. |
Rabbit Polyclonal Anti-Sgcd Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sgcd antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FVLLLMILILVNLAMTIWILKVMNFTIDGMGNLRITEKGLKLEGDSEFLQ |
Germany
Japan
United Kingdom
China