Primary Antibodies

Jump to Filters
View as table Download
RPL18 Rabbit Polyclonal Antibody
TA335159

USD 539.00

5 Days

Rabbit polyclonal Anti-RPL18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL18 antibody: synthetic peptide directed towards the N terminal of human RPL18. Synthetic peptide located within the following region: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR
RPL18 Rabbit Polyclonal Antibody
TA314462

USD 380.00

In Stock

Rabbit polyclonal anti-RPL18 antibody

Applications WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL18.