Primary Antibodies

Jump to Filters
View as table Download
NT5C1A Rabbit Polyclonal Antibody
TA315925

USD 380.00

In Stock

Rabbit polyclonal anti-NT5C1A antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NT5C1A.
NT5C1A Rabbit Polyclonal Antibody
TA342921

USD 539.00

5 Days

Rabbit Polyclonal Anti-NT5C1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NT5C1A antibody: synthetic peptide directed towards the C terminal of human NT5C1A. Synthetic peptide located within the following region: AHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIR