Primary Antibodies

View as table Download

Rabbit Polyclonal TRIP6 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRIP6 antibody was raised against a 15 amino acid synthetic peptide near the center of human TRIP6.

Rabbit Polyclonal Anti-TRIP6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP6 antibody: synthetic peptide directed towards the N terminal of human TRIP6. Synthetic peptide located within the following region: MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLP

Rabbit Polyclonal Anti-TRIP6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP6 antibody: synthetic peptide directed towards the middle region of human TRIP6. Synthetic peptide located within the following region: ASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVW