Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-CYB5R1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYB5R1. |
Goat Polyclonal Antibody against CHIT1 (aa409-423)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EHGPSPGQDTFCQGK, from the internal region (near C Terminus) of the protein sequence according to NP_003456.1. |
CHIT1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CHIT1 |
UXS 1 (UXS1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 336-366 amino acids from the C-terminal region of human UXS1 |
Rabbit polyclonal antibody to b5R.1 (cytochrome b5 reductase 1)
| Applications | WB |
| Reactivities | Human (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 275 of b5R.1 (Uniprot ID#Q9UHQ9) |
Rabbit polyclonal antibody to Chitotriosidase (chitinase 1 (chitotriosidase))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 216 and 463 of Chitotriosidase (Uniprot ID#Q13231) |
Rabbit Polyclonal Anti-UXS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UXS1 antibody: synthetic peptide directed towards the middle region of human UXS1. Synthetic peptide located within the following region: LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH |
UXS1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human UXS1 |
UXS1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UXS1 |
CHIT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CHIT1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- Amino sugar and nucleotide sugar metabolism