Primary Antibodies

View as table Download

Rabbit polyclonal anti-HEXB antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.

Rabbit polyclonal anti-CYB5R1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CYB5R1.

Rabbit polyclonal antibody to b5R.1 (cytochrome b5 reductase 1)

Applications WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 275 of b5R.1 (Uniprot ID#Q9UHQ9)

Rabbit polyclonal antibody to Chitotriosidase (chitinase 1 (chitotriosidase))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 216 and 463 of Chitotriosidase (Uniprot ID#Q13231)

Rabbit Polyclonal Anti-UXS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UXS1 antibody: synthetic peptide directed towards the middle region of human UXS1. Synthetic peptide located within the following region: LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH