Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-UCHL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-UCHL3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Uchl3 antibody is: synthetic peptide directed towards the middle region of Mouse Uchl3. Synthetic peptide located within the following region: IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET