Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal anti-E2F4 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F4 antibody: synthetic peptide directed towards the C terminal of human E2F4. Synthetic peptide located within the following region: SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL |
Goat Polyclonal Anti-E2F4 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_001941.2 (DPTGVLELPKELSE) |
Goat Polyclonal Anti-Transcription factor E2F4 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_001941.2 (PKELSEIFDPTR) |
Rabbit Polyclonal Anti-E2F4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F4 Antibody: A synthesized peptide derived from human E2F4 |
E2F4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of Human E2F4 |
Active filters
Target Symbol
- E2F4
Applications
- WB
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- Cell cycle