Primary Antibodies

Jump to Filters
View as table Download
RNF2 Rabbit Polyclonal Antibody
TA332768

USD 365.00

3 Weeks

Rabbit anti-RNF2 Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RNF2
RNF2 Rabbit Polyclonal Antibody
TA335663

USD 539.00

5 Days

Rabbit Polyclonal Anti-RNF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RNF2 Antibody: synthetic peptide directed towards the middle region of human RNF2. Synthetic peptide located within the following region: NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVF
RNF2 Rabbit Polyclonal Antibody
TA359215

USD 539.00

5 Days

RNF2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human RNF2