Primary Antibodies

Jump to Filters
View as table Download
CBS Rabbit Polyclonal Antibody
TA338394

USD 485.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
S adenosylhomocysteine hydrolase (AHCY) Rabbit Polyclonal Antibody
TA332593

USD 365.00

In Stock

Rabbit anti-AHCY Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AHCY