Primary Antibodies

Jump to Filters
View as table Download
TFIIE alpha (GTF2E1) Rabbit Polyclonal Antibody
TA330119

USD 539.00

5 Days

Rabbit Polyclonal Anti-GTF2E1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E1 antibody: synthetic peptide directed towards the C terminal of human GTF2E1. Synthetic peptide located within the following region: VADDPIVMVAGRPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE
TFIIE alpha (GTF2E1) Rabbit Polyclonal Antibody
TA330103

USD 539.00

5 Days

Rabbit Polyclonal Anti-GTF2E1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E1 antibody: synthetic peptide directed towards the N terminal of human GTF2E1. Synthetic peptide located within the following region: DHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFC