Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-POGZ Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POGZ antibody: synthetic peptide directed towards the N terminal of human POGZ. Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA

Rabbit polyclonal anti-Pogz antibody

Applications WB
Reactivities Human, Dog, Bovine, Macaque, Chicken, Rat, Chimpanzee, Opossum, Baboon
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of mouse Pogz protein.

Rabbit Polyclonal Anti-POGZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POGZ Antibody: synthetic peptide directed towards the middle region of human POGZ. Synthetic peptide located within the following region: STMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQPT

Rabbit Polyclonal Anti-POGZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POGZ antibody: synthetic peptide directed towards the C terminal of human POGZ. Synthetic peptide located within the following region: ASLEEQLKLSGEHSESSTPRPRSSPEETIEPESLHQLFEGESETESFYGF