Primary Antibodies

Jump to Filters
View as table Download
GSTA5 Rabbit Polyclonal Antibody
TA372695

USD 380.00

4 Weeks

GSTA5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GSTA5
GSTA5 Rabbit Polyclonal Antibody
TA330990

USD 539.00

5 Days

Rabbit polyclonal Anti-GSTA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTA5 antibody: synthetic peptide directed towards the middle region of human GSTA5. Synthetic peptide located within the following region: QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE