Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH

Rabbit polyclonal Claudin 11 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 11.

Rabbit anti-CLDN11 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CLDN11

Rabbit Polyclonal Anti-Claudin 11 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11

Rabbit Polyclonal Anti-Claudin 11 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Cow
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11