Primary Antibodies

Jump to Filters
View as table Download
RDH8 Rabbit Polyclonal Antibody
TA338059

USD 539.00

5 Days

Rabbit Polyclonal Anti-RDH8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RDH8 antibody is: synthetic peptide directed towards the middle region of Human RDH8. Synthetic peptide located within the following region: FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKF
RDH8 Rabbit Polyclonal Antibody
TA361475

USD 539.00

5 Days

RDH8 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RDH8