Rabbit Polyclonal EGLN1/PHD2 Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of mouse PHD2/HIF Prolyl Hydroxylase 2 (between residues 300-400). [UniProt# Q91YE3] |
EGLN1 (1-50) mouse monoclonal antibody, clone 366G/76/3
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EGLN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN1 antibody: synthetic peptide directed towards the C terminal of human EGLN1. Synthetic peptide located within the following region: QPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF |
EGLN1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EGLN1 |
Germany
Japan
United Kingdom
China
