Primary Antibodies

Jump to Filters
View as table Download
PDE7B Rabbit Polyclonal Antibody
TA333748

USD 539.00

5 Days

Rabbit Polyclonal Anti-PDE7B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE7B Antibody: synthetic peptide directed towards the middle region of human PDE7B. Synthetic peptide located within the following region: IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
PDE7B (C-term) Rabbit Polyclonal Antibody
AP53239PU-N

USD 580.00

2 Weeks

PDE7B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 424-454 amino acids from the C-terminal region of Human PDE7B