Rabbit Polyclonal Anti-CA7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CA7 antibody: synthetic peptide directed towards the C terminal of human CA7. Synthetic peptide located within the following region: SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR |
Rabbit Polyclonal Anti-CA7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CA7 antibody is: synthetic peptide directed towards the middle region of Human CA7. Synthetic peptide located within the following region: YRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASA |
Germany
Japan
United Kingdom
China