Primary Antibodies

View as table Download

IL15 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL15 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL15 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications WB
Reactivities Human
Conjugation Unconjugated

IL15 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications WB
Reactivities Human
Conjugation Unconjugated

IL15 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

IL15 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

IL15 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

IL15 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Rabbit Polyclonal IL-15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal IL-15 antibody was raised against a 13 amino acid peptide near the center of human IL-15.

Rabbit polyclonal Anti-IL15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL15 antibody: synthetic peptide directed towards the N terminal of human IL15. Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV