Germany
Japan
United Kingdom
China
SA1 (STAG1) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 539-568 amino acids from the Central region of human STAG1 |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-STAG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-STAG1 antibody is: synthetic peptide directed towards the N-terminal region of HUMAN STAG1. Synthetic peptide located within the following region: PRKSPGEKSRIEAGIRGAGRGRANGHPQQNGEGEPVTLFEVVKLGKSAMQ |
