Germany
Japan
United Kingdom
China
GTF2H3 mouse monoclonal antibody,clone OTI4B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
GTF2H3 mouse monoclonal antibody,clone OTI6E12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2H3 mouse monoclonal antibody,clone OTI4B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2H3 mouse monoclonal antibody,clone OTI6E12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
GTF2H3 mouse monoclonal antibody,clone OTI4B5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GTF2H3 mouse monoclonal antibody,clone OTI4B5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
GTF2H3 mouse monoclonal antibody,clone OTI6E12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GTF2H3 mouse monoclonal antibody,clone OTI6E12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit Polyclonal anti-GTF2H3 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H3 antibody: synthetic peptide directed towards the N terminal of human GTF2H3. Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN |
Rabbit Polyclonal anti-GTF2H3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GTF2H3 antibody is: synthetic peptide directed towards the middle region of Human GTF2H3. Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY |
GTF2H3 mouse monoclonal antibody,clone OTI4B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GTF2H3 mouse monoclonal antibody,clone OTI6E12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
- Antibodies
Target Symbol
- GTF2H3
Applications
- WB
Pathways
- Basal transcription factors