Primary Antibodies

View as table Download

Rabbit polyclonal anti-TF2E2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TF2E2.

Rabbit Polyclonal anti-GTF2E2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: VEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRG

Rabbit Polyclonal Anti-GTF2E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the N terminal of human GTF2E2. Synthetic peptide located within the following region: MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSG

Rabbit Polyclonal Anti-GTF2E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2E2 antibody: synthetic peptide directed towards the middle region of human GTF2E2. Synthetic peptide located within the following region: ISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK

GTF2E2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human GTF2E2

GTF2E2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2E2