Rabbit Polyclonal Anti-FOXP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP2 antibody: synthetic peptide directed towards the N terminal of human FOXP2. Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA |
Rabbit Polyclonal Anti-FOXP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP2 antibody: synthetic peptide directed towards the N terminal of human FOXP2. Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA |
Goat Polyclonal Antibody against FOXP2
| Applications | PEP-ELISA, WB |
| Reactivities | Human, Mouse, Rat, Dog, Pig, Cow |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-REIEEEPLSEDLE, from the C Terminus of the protein sequence according to NP_055306.1; NP_683696.2; NP_683697.1. |
Rabbit polyclonal FOXP2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | This FOXP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 657-684 amino acids from the C-terminal region of human FOXP2. |
Goat Polyclonal Antibody against FOXP2 (Internal region)
| Applications | WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Feline, Dog, Pig, Cow, Zebrafish) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEVEYQKRRSQKIT, from the internal region of the protein sequence according to NP_055306.1; NP_683696.1; NP_683697.1; NP_683698.1. |
Rabbit anti-FOXP2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FOXP2 |
Rabbit Polyclonal Anti-FOXP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXP2 Antibody: Peptide sequence around aa.707~711(E-E-P-L-S) derived from Human FOXP2. |
Germany
Japan
United Kingdom
China
