Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GNA12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNA12 antibody: synthetic peptide directed towards the middle region of human GNA12. Synthetic peptide located within the following region: TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF

Rabbit Polyclonal Anti-GNA12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNA12 antibody is: synthetic peptide directed towards the C-terminal region of Human GNA12. Synthetic peptide located within the following region: PDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFH