Primary Antibodies

View as table Download

Goat Polyclonal Antibody against CES1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NTQAAQKLKDKE, from the internal region (near C terminus) of the protein sequence according to NP_001020366.1; NP_001020365.1; NP_001257.4.

Rabbit Polyclonal Anti-CES1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES1 antibody: synthetic peptide directed towards the N terminal of human CES1. Synthetic peptide located within the following region: VLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATS

Rabbit anti-CES1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CES1

Rabbit Polyclonal Anti-CES1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES1 antibody: synthetic peptide directed towards the C terminal of human CES1. Synthetic peptide located within the following region: ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL