Primary Antibodies

Jump to Filters
View as table Download
KCNK6 Rabbit Polyclonal Antibody
TA328631

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-K2P6.1

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)ESHQQLSASSHTDYASIPR, corresponding to residues 295-313 of human K2P6.1 (TWIK-2).Intracellular, C-terminus.
KCNK6 Rabbit Polyclonal Antibody
TA341716

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK6 antibody: synthetic peptide directed towards the n terminal of human KCNK6. Synthetic peptide located within the following region: RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK