Primary Antibodies

View as table Download

Rabbit polyclonal anti-LAMC1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMC1.

Laminin gamma 1 (LAMC1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-LAMC1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMC1 antibody: synthetic peptide directed towards the middle region of human LAMC1. Synthetic peptide located within the following region: GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ

Rabbit Polyclonal Anti-LAMC1 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMC1 antibody: synthetic peptide directed towards the middle region of human LAMC1. Synthetic peptide located within the following region: KTREAQQALGSAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAE