Primary Antibodies

View as table Download

UBE2Z Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-UBE2Z Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ube2z antibody is: synthetic peptide directed towards the C-terminal region of Rat Ube2z. Synthetic peptide located within the following region: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD