Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-P2Y13 Receptor

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide DRFLKIIRPLRNIFLK(C), corresponding to amino acid residues 119-134 of human P2Y13. 2nd Intracellular loop.

Rabbit polyclonal anti-P2RY13 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human P2RY13.

Rabbit Polyclonal Anti-P2RY13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RY13 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY13. Synthetic peptide located within the following region: YTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEK

P2RY13 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated