Rabbit Polyclonal Anti-P2Y13 Receptor
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide DRFLKIIRPLRNIFLK(C), corresponding to amino acid residues 119-134 of human P2Y13. 2nd Intracellular loop. |
Rabbit Polyclonal Anti-P2Y13 Receptor
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide DRFLKIIRPLRNIFLK(C), corresponding to amino acid residues 119-134 of human P2Y13. 2nd Intracellular loop. |
Rabbit polyclonal anti-P2RY13 antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human P2RY13. |
Rabbit Polyclonal Anti-P2RY13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-P2RY13 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY13. Synthetic peptide located within the following region: YTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEK |
P2RY13 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |