Primary Antibodies

Jump to Filters
View as table Download
GHRHR Rabbit Polyclonal Antibody
TA311715

USD 380.00

4 Weeks

Rabbit polyclonal anti-GHRHR antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GHRHR.
GHRHR Rabbit Polyclonal Antibody
TA376560

USD 365.00

3 Weeks

GHRHR Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GHRHR (NP_000814.2).
Modifications Unmodified
GHRHR Rabbit Polyclonal Antibody
TA346229

USD 539.00

5 Days

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the N terminal of human GHRHR. Synthetic peptide located within the following region: VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE
GHRHR Rabbit Polyclonal Antibody
TA346230

USD 539.00

5 Days

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the middle region of human GHRHR. Synthetic peptide located within the following region: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR
GHRHR Rabbit Polyclonal Antibody
TA346246

USD 539.00

5 Days

Rabbit Polyclonal Anti-GHRHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the C terminal of human GHRHR. Synthetic peptide located within the following region: YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV