ATP5C1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-298 of human ATP5C1 (NP_001001973.1). |
| Modifications | Unmodified |
ATP5C1 (aa27-40) Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Rat (Expected from sequence similarity: Human, Mouse, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Internal region (near N terminus) (TLKDITRRLKSIKN) |
Rabbit Polyclonal Anti-Atp5c1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Atp5c1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Atp5c1. Synthetic peptide located within the following region: VRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGT |
Germany
Japan
United Kingdom
China
