Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PDE7A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE7A antibody is: synthetic peptide directed towards the C-terminal region of Human PDE7A. Synthetic peptide located within the following region: DRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQ

PDE7A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated