Primary Antibodies

Jump to Filters
View as table Download
SNRPB (N-term) Rabbit Polyclonal Antibody
AP18203PU-N

USD 580.00

2 Weeks

SNRPB (N-term) rabbit polyclonal antibody

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 42~72 amino acids from the N-terminal region of Human SNRPB
SNRPB Rabbit Polyclonal Antibody
TA345826

USD 539.00

5 Days

Rabbit Polyclonal Anti-SNRPB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPB antibody: synthetic peptide directed towards the middle region of human SNRPB. Synthetic peptide located within the following region: LRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMP
SNRPB Rabbit Polyclonal Antibody
TA345827

USD 539.00

5 Days

Rabbit Polyclonal Anti-SNRPB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPB antibody: synthetic peptide directed towards the N terminal of human SNRPB. Synthetic peptide located within the following region: DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG