Primary Antibodies

View as table Download

Rabbit polyclonal anti-HSP105 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP105.

Rabbit Polyclonal Anti-HSPH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPH1 antibody: synthetic peptide directed towards the middle region of human HSPH1. Synthetic peptide located within the following region: EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ

Anti-HSPH1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human heat shock 105kDa/110kDa protein 1

Anti-HSPH1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human heat shock 105kDa/110kDa protein 1

Rabbit Polyclonal Anti-HSP105 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSP105 Antibody: A synthesized peptide derived from human HSP105