Primary Antibodies

Jump to Filters
View as table Download
OR52I2 (C-term) Rabbit Polyclonal Antibody
AP53078PU-N

USD 580.00

2 Weeks

OR52I2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 312-341 amino acids from the C-terminal region of human OR52I2
OR52I2 Rabbit Polyclonal Antibody
TA332298

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR52I2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR52I2 Antibody is: synthetic peptide directed towards the N-terminal region of Human OR52I2. Synthetic peptide located within the following region: SSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLLTMAFDRYV