Primary Antibodies

View as table Download

Rabbit polyclonal Keratin 19 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Keratin 19.

Rabbit anti Cytokeratin-19 (CK-19) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human Cytokeratin protein.

Goat Anti-cytokeratin 19 (aa285-298) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HTEQLQMSRSEVTD, from the internal region of the protein sequence according to NP_002267.2.

Goat Anti-cytokeratin 19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EGQEDHYNNLSASK, from the C Terminus of the protein sequence according to NP_002267.2.

Rabbit Polyclonal Anti-KRT19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRT19 antibody is: synthetic peptide directed towards the middle region of Human KRT19. Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR

Rabbit Polyclonal Anti-Keratin 19 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Keratin 19 Antibody: A synthesized peptide derived from human Keratin 19