Primary Antibodies

Jump to Filters
View as table Download
GPR75 Rabbit Polyclonal Antibody
TA332022

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-GPR75 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR75 Antibody: synthetic peptide directed towards the middle region of human GPR75. Synthetic peptide located within the following region: GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY
GPR75 Rabbit Polyclonal Antibody
TA315128

USD 380.00

4 Weeks

Rabbit polyclonal anti-GPR75 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR75.
GPR75 Rabbit Polyclonal Antibody
TA332023

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR75 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR75 Antibody: synthetic peptide directed towards the middle region of human GPR75. Synthetic peptide located within the following region: PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS
GPR75 Rabbit Polyclonal Antibody
TA334745

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR75 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR75 antibody: synthetic peptide directed towards the C terminal of human GPR75. Synthetic peptide located within the following region: ALYRNQNYNKLQHVQTRGYTKSPNQLVTPAASRLQLVSAINLSTAKDSKA