Primary Antibodies

Jump to Filters
View as table Download
GRPR Rabbit Polyclonal Antibody
TA321704

USD 380.00

In Stock

Anti-GRPR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 350-365 amino acids of Human gastrin-releasing peptide receptor
alpha 1a Adrenergic Receptor (ADRA1A) Rabbit Polyclonal Antibody
TA323589

USD 380.00

In Stock

Anti-ADRA1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 152-165 amino acids of human adrenoceptor alpha 1A
Thromboxane A2 receptor (TBXA2R) Rabbit Polyclonal Antibody
TA351878

USD 380.00

In Stock

Rabbit Polyclonal Anti-TBXA2R Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TBXA2R
PTGER3 Rabbit Polyclonal Antibody
TA313293

USD 380.00

In Stock

Rabbit polyclonal anti-PE2R3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PE2R3.
BDKRB1 Goat Polyclonal Antibody
TA302436

USD 520.00

In Stock

Goat Polyclonal Antibody against Bradykinin receptor B1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2.
Endothelin B Receptor (EDNRB) Rabbit Polyclonal Antibody
TA322809

USD 380.00

In Stock

Anti-EDNRB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 70-84 amino acids of human endothelin receptor type B
alpha 1a Adrenergic Receptor (ADRA1A) Rabbit Polyclonal Antibody
TA323590

USD 380.00

In Stock

Anti-ADRA1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 152-165 amino acids of human adrenoceptor alpha 1A
CHRM2 Rabbit Polyclonal Antibody
TA313310

USD 380.00

In Stock

Rabbit polyclonal anti-CHRM2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHRM2.
Endothelin A Receptor (EDNRA) Rabbit Polyclonal Antibody
TA313783

USD 380.00

In Stock

Rabbit polyclonal anti-EDNRA antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human EDNRA.
Endothelin A Receptor (EDNRA) Rabbit Polyclonal Antibody
TA313784

USD 380.00

In Stock

Rabbit polyclonal anti-EDNRA antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human EDNRA.
Thrombin Receptor (F2R) Goat Polyclonal Antibody
TA305911

USD 520.00

In Stock

Goat Anti-F2R / PAR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRARRPESKATNAT, from the Internal region (near N-terminus) of the protein sequence according to NP_001983.2.
BDKRB1 Rabbit Polyclonal Antibody
TA311799

USD 380.00

In Stock

Rabbit polyclonal anti-BDKRB1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BDKRB1.
Modifications Phospho-specific
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
TA314043

USD 380.00

In Stock

Rabbit polyclonal anti-HTR4 antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HTR4.
BDKRB2 Rabbit Polyclonal Antibody
TA321167

USD 380.00

In Stock

Anti-BDKRB2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA329147

USD 485.00

In Stock

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV